Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida UPF0299 membrane protein PM0880 (PM0880)

This Recombinant Pasteurella multocida UPF0299 membrane protein PM0880 (PM0880) spans the amino acid sequence from region 1-136.

Product Specifications

Product Name Alternative

UPF0299 membrane protein PM0880

UniProt

Q9CME9

Expression Region

1-136

Origin

Pasteurella multocida (strain Pm70)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTRKIVDLARSCGILYLMLFIGEWIAHHLNIGIPASIWGLLLLFLGLTFRIIKLDWVLCS ASLLIRYMALLFVPVSVGVIKYADVLFSQMNVLLLPNIVSTFLTLIVVGLLSDYLFSLSS FSHLRKKVARKQAEKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Azin2 Mouse Gene Knockout Kit (CRISPR)
KN500880 1 Kit

Azin2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
H2AZ2 (NM_012412) Human Over-expression Lysate
LC402207 20 µg

H2AZ2 (NM_012412) Human Over-expression Lysate

Sign In for Pricing
View Details
Enocyanin
TRC-E262365-25G 25 g

Enocyanin

Sign In for Pricing
View Details
Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit
E-CL-H0108-01 24 Tests

Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit

Sign In for Pricing
View Details
Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit
E-CL-H0108-02 48 Tests

Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit

Sign In for Pricing
View Details
Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit
E-CL-H0108-03 96 Tests

Human TNF-α (Tumor Necrosis Factor Alpha) CLIA Kit

Sign In for Pricing
View Details