Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1792

UniProt

O28482

Expression Region

1-137

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLCISNIMLEKPNKGGIMRYGKIGVATAMAVGAAVGYAVESGKWFITVIAVLAGVALLSL VKRRVDEVVEDERTVRVGERASRRTVEIFSIGAALSGAVMLALDLHTEAALALEFAVCCV LVLYLIFYGYYSFRALD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Bcl2l11 activation kit by CRISPRa
GA200409 1 Kit

Mouse Bcl2l11 activation kit by CRISPRa

Sign In for Pricing
View Details
4"-Des-morpholino,-4"-acetamido Momelotinib
TRC-D965710-10MG 10 mg

4"-Des-morpholino,-4"-acetamido Momelotinib

Sign In for Pricing
View Details
Steap3 Mouse Gene Knockout Kit (CRISPR)
KN516857 1 Kit

Steap3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tubeimoside A
TRC-T897030-10MG 10 mg

Tubeimoside A

Sign In for Pricing
View Details
Recombinant Human TREML2/TLT2 Protein (His Tag)
PKSH031041 100 µg

Recombinant Human TREML2/TLT2 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant SP1 Monoclonal Antibody
AN301966L-01 50 µL

Recombinant SP1 Monoclonal Antibody

Sign In for Pricing
View Details