Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1792 (AF_1792) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_1792

UniProt

O28482

Expression Region

1-137

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLCISNIMLEKPNKGGIMRYGKIGVATAMAVGAAVGYAVESGKWFITVIAVLAGVALLSL VKRRVDEVVEDERTVRVGERASRRTVEIFSIGAALSGAVMLALDLHTEAALALEFAVCCV LVLYLIFYGYYSFRALD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SQSTM1 Rabbit Monoclonal Antibody [Clone ID: R08-4H8]
TA385315 100 µL

SQSTM1 Rabbit Monoclonal Antibody [Clone ID: R08-4H8]

Sign In for Pricing
View Details
ZNF237 (ZMYM5) (NM_001039649) Human Over-expression Lysate
LY422097 100 µg

ZNF237 (ZMYM5) (NM_001039649) Human Over-expression Lysate

Sign In for Pricing
View Details
MTRF1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]
TA813065BM 100 µL

MTRF1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D3]

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL
BNC680917-500 1x 500 µL

Mucin 5AC (MUC5AC) (MUC5AC/917), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
UCMA antibody
FNab09225 100 µg

UCMA antibody

Sign In for Pricing
View Details
NDUFA7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G4]
TA502658AM 100 µL

NDUFA7 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2G4]

Sign In for Pricing
View Details