Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Protein CrcB homolog 1 (crcB1)

This Recombinant Bacillus cereus Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q631P4

Expression Region

1-137

Origin

Bacillus cereus (strain ZK / E33L)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKLIYIMVGIAGILGALSRYYLGLTIHEFWHHTFPLATLLINLAGCFLLAWLTTYIAKL NILPSDVITGIGTGFIGSFTTFSTFSVETIQLINHFEWGIAFLYVSCSILGGLIMSGLGY TLGDFLLKKHLTEGDHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-100 1x 100 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL
BNC740745-500 1x 500 µL

CD45 / LCA (2B11 + PD7/26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL
BNC880257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF405S conjugate, 0.1mg/mL
BNC042416-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2416), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF405S conjugate, 0.1mg/mL
BNC040484-100 1x 100 µL

Progesterone Receptor (PR484), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details