Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CrcB homolog 1 (crcB1)

This Recombinant Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-137.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q81XC1

Expression Region

1-137

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRKLIYIIVGIAGILGALSRYYLGLTIHEFWHHTFPLATLLINLAGCFLLAWLTTYIAKL NILPSDVITGIGTGFIGSFTTFSTLSVETIQLINHSEWGIAFLYVSCSILGGLIMSGLGY TLGDFLLKKHLTEGDHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
BNC471003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
BNC400679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL
BNC680633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2644), CF568 conjugate, 0.1mg/mL
BNC682644-100 1x 100 µL

Prolactin (Pituitary Tumor Marker) (PRL/2644), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details