Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CrcB homolog (crcB)

This Recombinant Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-138.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q8FMR6

Expression Region

1-138

Origin

Corynebacterium efficiens

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQVSIPVCYPCPSFPQTRPFAGDGRKFGRVDSGFMPKLWEGLSVGAGAAVGACARLALTM QFGEGLWPILAINMLGSFLMGRYRPGPFWGTGVLGGFTTFSAFAVVLVDVPLPHAVAYLT VTVVSCVAAWLMGNRWSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-500 1x 500 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), 1mg/mL
BNUM0008-50 1x 50 µL

MAGE A1 (MA454), 1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF405S conjugate, 0.1mg/mL
BNC042038-100 1x 100 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (LAMP4/1830), CF640R conjugate, 0.1mg/mL
BNC401830-100 1x 100 µL

CD68 (Macrophage Marker) (LAMP4/1830), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL
BNC402759-100 1x 100 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2759), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (34BE12), CF647 conjugate, 0.1mg/mL
BNC470446-500 1x 500 µL

Cytokeratin, HMW (34BE12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details