Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Probable disulfide formation protein C (bdbC)

This Recombinant Bacillus cereus Probable disulfide formation protein C (bdbC) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Probable disulfide formation protein C, Disulfide oxidoreductase C, Thiol-disulfide oxidoreductase C

UniProt

Q81HM5

Expression Region

1-139

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGREKKQEYALLTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVAK KDYRIASYSLPIASIGACISLYHYAIQKVAAFSAAGAACGRVPCTGEYINWFGFVTIPFL ALIGFITIAVCSFIVIKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pancreatic Polypeptide Recombinant Rabbit monoclonal Antibody
HA750664 100 µL

Pancreatic Polypeptide Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Apba2 activation kit by CRISPRa
GA200221 1 Kit

Mouse Apba2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF405S conjugate, 0.1mg/mL
BNC041986-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/1986), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AFM Rabbit Polyclonal Antibody
TA373339 100 µL

AFM Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BRCA1 / RNF53 (N-term) Rabbit Polyclonal Antibody
AP33262PU-N 400 µL

BRCA1 / RNF53 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VEGFC Mouse Monoclonal Antibody [Clone ID: 9/G10]
AM33409PU-N 100 µg

VEGFC Mouse Monoclonal Antibody [Clone ID: 9/G10]

Sign In for Pricing
View Details