Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Probable disulfide formation protein C (bdbC)

This Recombinant Bacillus cereus Probable disulfide formation protein C (bdbC) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Probable disulfide formation protein C, Disulfide oxidoreductase C, Thiol-disulfide oxidoreductase C

UniProt

Q81HM5

Expression Region

1-139

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGREKKQEYALLTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVAK KDYRIASYSLPIASIGACISLYHYAIQKVAAFSAAGAACGRVPCTGEYINWFGFVTIPFL ALIGFITIAVCSFIVIKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CA150 (TCERG1) (NM_001040006) Human Over-expression Lysate
LY421873 100 µg

CA150 (TCERG1) (NM_001040006) Human Over-expression Lysate

Sign In for Pricing
View Details
AATOM™ 633 acid
70270-AAT 5 mg

AATOM™ 633 acid

Sign In for Pricing
View Details
ISYNA1 Recombinant Rabbit monoclonal Antibody
HA751146 100 µL

ISYNA1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
GLG1 (Golgi Complex) (GLG1/970), CF568 conjugate, 0.1mg/mL
BNC680970-500 1x 500 µL

GLG1 (Golgi Complex) (GLG1/970), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MIXL1 Rabbit Polyclonal Antibody
TA378538 100 µL

MIXL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4-Phenylmorpholine
TRC-P336605-25G 25 g

4-Phenylmorpholine

Sign In for Pricing
View Details