Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus cereus Probable disulfide formation protein C (bdbC)

This Recombinant Bacillus cereus Probable disulfide formation protein C (bdbC) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Probable disulfide formation protein C, Disulfide oxidoreductase C, Thiol-disulfide oxidoreductase C

UniProt

Q81HM5

Expression Region

1-139

Origin

Bacillus cereus (strain ATCC 14579 / DSM 31)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGREKKQEYALLTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVAK KDYRIASYSLPIASIGACISLYHYAIQKVAAFSAAGAACGRVPCTGEYINWFGFVTIPFL ALIGFITIAVCSFIVIKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

katanin p80 (KATNB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A10]
TA503807AM 100 µL

katanin p80 (KATNB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A10]

Sign In for Pricing
View Details
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF568 conjugate, 0.1mg/mL
BNC682231-100 1x 100 µL

14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human WBS28 (WBSCR28) activation kit by CRISPRa
GA115254 1 Kit

Human WBS28 (WBSCR28) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human LDHB protein (His tag)
PDEH100952-01 20 µg

Recombinant Human LDHB protein (His tag)

Sign In for Pricing
View Details
Recombinant Human LDHB protein (His tag)
PDEH100952-02 100 µg

Recombinant Human LDHB protein (His tag)

Sign In for Pricing
View Details
Recombinant Human LDHB protein (His tag)
PDEH100952-03 500 µg

Recombinant Human LDHB protein (His tag)

Sign In for Pricing
View Details