Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable disulfide formation protein C 1 (bdbC1)

This Recombinant Probable disulfide formation protein C 1 (bdbC1) spans the amino acid sequence from region 1-139.

Product Specifications

Product Name Alternative

Probable disulfide formation protein C 1, Disulfide oxidoreductase C 1, Thiol-disulfide oxidoreductase C 1

UniProt

Q81UU9

Expression Region

1-139

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGREKKQEYALFTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVVK KDYRIASYSLPIASIGACISLYHYVIQKVAAFSAAGAACGRVPCTGEYINWFGFVTIPFL ALIGFITIAVCSFIVIKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rabies virus Matrix protein (M)
MBS1058429-01 0.02 mg (E-Coli)

Recombinant Rabies virus Matrix protein (M)

Sign In for Pricing
View Details
Recombinant Rabies virus Matrix protein (M)
MBS1058429-02 0.1 mg (E-Coli)

Recombinant Rabies virus Matrix protein (M)

Sign In for Pricing
View Details
Recombinant Rabies virus Matrix protein (M)
MBS1058429-03 0.02 mg (Yeast)

Recombinant Rabies virus Matrix protein (M)

Sign In for Pricing
View Details
Recombinant Rabies virus Matrix protein (M)
MBS1058429-04 0.1 mg (Yeast)

Recombinant Rabies virus Matrix protein (M)

Sign In for Pricing
View Details
Recombinant Rabies virus Matrix protein (M)
MBS1058429-05 0.02 mg (Baculovirus)

Recombinant Rabies virus Matrix protein (M)

Sign In for Pricing
View Details
Recombinant Rabies virus Matrix protein (M)
MBS1058429-06 0.02 mg (Mammalian-Cell)

Recombinant Rabies virus Matrix protein (M)

Sign In for Pricing
View Details