Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein yphA (yphA)

This Recombinant Inner membrane protein yphA (yphA) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Inner membrane protein yphA

UniProt

P0AD48

Expression Region

1-140

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNTLRYFDFGAARPVLLLIARIAVVLIFIIFGFPKMMGFDGTVQYMASLGAPMPMLAAII AVVMEVPAAILIVLGFFTRPLAVLFIFYTLGTAVIGHHYWDMTGDAVGPNMINFWKNVSI AGAFLLLAITGPGAISLDRR

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-BUTYLPYRIDINE
539-32-2 1 Each

3-BUTYLPYRIDINE

Sign In for Pricing
View Details
SLC6A15 Protein Vector (Rat) (pPM-C-His)
PV306333 500 ng

SLC6A15 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
ELISA Kit For GTP-binding protein RAD
E15521r 96 Tests

ELISA Kit For GTP-binding protein RAD

Sign In for Pricing
View Details
Septin 6 Rabbit Polyclonal Antibody
E28PT4250 100 µL

Septin 6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse IL13 Protein (Pro22-Phe131)
MBS8249231-01 0.01 mg

Recombinant Mouse IL13 Protein (Pro22-Phe131)

Sign In for Pricing
View Details
Recombinant Mouse IL13 Protein (Pro22-Phe131)
MBS8249231-02 0.05 mg

Recombinant Mouse IL13 Protein (Pro22-Phe131)

Sign In for Pricing
View Details