Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 107 (Tmem107)

This Recombinant Mouse Transmembrane protein 107 (Tmem107) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Transmembrane protein 107

UniProt

Q9CPV0

Expression Region

1-140

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRISGLVPSRFLTLLAHLVVVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLT LGLFAVELAGFLSGVSMFNSTQSLLSIAAHCSASVALSFFVFERWECTTYWYIFTFCSAF PAVTETALFIAVFGLKKKPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-κB p65 (Ab-254) Antibody
8B7172-AAT 50 µg

NF-κB p65 (Ab-254) Antibody

Sign In for Pricing
View Details
HRCT1 (NM_001039792) Human Over-expression Lysate
LC421830 20 µg

HRCT1 (NM_001039792) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Adducin 2 (ADD2) activation kit by CRISPRa
GA100081 1 Kit

Human Adducin 2 (ADD2) activation kit by CRISPRa

Sign In for Pricing
View Details
NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF594 conjugate, 0.1mg/mL
BNC941997-500 1x 500 µL

NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker) (NGFR/1997R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PKC α (Ab-638) Antibody
8B0716-AAT 50 µg

PKC α (Ab-638) Antibody

Sign In for Pricing
View Details
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), CF647 conjugate, 0.1mg/mL
BNC473775-100 1x 100 µL

IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (rIM260), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details