Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 107 (Tmem107)

This Recombinant Mouse Transmembrane protein 107 (Tmem107) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Transmembrane protein 107

UniProt

Q9CPV0

Expression Region

1-140

Origin

Mus musculus (Mouse)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRISGLVPSRFLTLLAHLVVVITLFWSRESNIQACLPLKFTPEEYEKQDNQLVAALCLT LGLFAVELAGFLSGVSMFNSTQSLLSIAAHCSASVALSFFVFERWECTTYWYIFTFCSAF PAVTETALFIAVFGLKKKPF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Granulocyte Chemotactic Protein 2 (GCP2) ELISA Kit
abx360026 96 Well

Monkey Granulocyte Chemotactic Protein 2 (GCP2) ELISA Kit

Sign In for Pricing
View Details
MZB1 Rabbit Polyclonal Antibody (Fluoro647)
orb3099013 100 µg

MZB1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
C-Src (phospho Tyr216) rabbit pAb
ES7264-01 50 µL

C-Src (phospho Tyr216) rabbit pAb

Sign In for Pricing
View Details
C-Src (phospho Tyr216) rabbit pAb
ES7264-02 100 µL

C-Src (phospho Tyr216) rabbit pAb

Sign In for Pricing
View Details
Tmprss15 (HRP)
579505-01 50 µg

Tmprss15 (HRP)

Sign In for Pricing
View Details
Tmprss15 (HRP)
579505-02 100 µg

Tmprss15 (HRP)

Sign In for Pricing
View Details