Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Probable ergosterol biosynthetic protein 28

This Recombinant Pongo abelii Probable ergosterol biosynthetic protein 28 spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Probable ergosterol biosynthetic protein 28

UniProt

Q5R589

Expression Region

1-140

Origin

Pongo abelii (Sumatran orangutan)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSRFLNVLRSWLVMVSIIAMGNTLQSFRDHTFLYEKLYTGKPNLVNGLQARTFGIWTLLS SVIRCLCAIDIHNKTLYHITLWTFLLALGHFLSELFVYGTAAPTIGVLAPLMVASFSILG MLVGLRYLEVEPVSRQKKRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL
BNC680679-500 1x 500 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-500 1x 500 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/155), CF405S conjugate, 0.1mg/mL
BNC040155-500 1x 500 µL

CD19 (CVID3/155), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF488A conjugate, 0.1mg/mL
BNC881126-500 1x 500 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calcineurin B / PPP3R1 (CALNB/2342), CF647 conjugate, 0.1mg/mL
BNC472342-100 1x 100 µL

Calcineurin B / PPP3R1 (CALNB/2342), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details