Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable disulfide formation protein C 2 (bdbC2)

This Recombinant Probable disulfide formation protein C 2 (bdbC2) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Probable disulfide formation protein C 2, Disulfide oxidoreductase C 2, Thiol-disulfide oxidoreductase C 2

UniProt

Q8KYH8

Expression Region

1-140

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIIRKYHIAIAWTIATSAMLISLIFSEWMKLPPCDLCWYQRMAMYPLVLILGIGMYRKD SNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCTENYLNLFGFISIPMLSFV GFLAIIILLYINQIKRQKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S-Deoxy-5-Hydroxy Acetate Omeprazole-d3
TRC-D245517-5MG 5 mg

S-Deoxy-5-Hydroxy Acetate Omeprazole-d3

Sign In for Pricing
View Details
CNDP2 Antibody - middle region : HRP (ARP57167_P050-HRP)
ARP57167_P050-HRP 100 µL

CNDP2 Antibody - middle region : HRP (ARP57167_P050-HRP)

Sign In for Pricing
View Details
YrdC (E-10) : m-IgG2a BP-HRP Bundle
sc-546518 1 Kit

YrdC (E-10) : m-IgG2a BP-HRP Bundle

Sign In for Pricing
View Details
Human Mesothelin Antibody (Amatuximab, Research Grade)
NC078 50 µg

Human Mesothelin Antibody (Amatuximab, Research Grade)

Sign In for Pricing
View Details
Human Platelet receptor Gi24 (C10orf54) ELISA Kit
MBS282858-01 48 Tests

Human Platelet receptor Gi24 (C10orf54) ELISA Kit

Sign In for Pricing
View Details
Human Platelet receptor Gi24 (C10orf54) ELISA Kit
MBS282858-02 96 Tests

Human Platelet receptor Gi24 (C10orf54) ELISA Kit

Sign In for Pricing
View Details