Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable disulfide formation protein C 2 (bdbC2)

This Recombinant Probable disulfide formation protein C 2 (bdbC2) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Probable disulfide formation protein C 2, Disulfide oxidoreductase C 2, Thiol-disulfide oxidoreductase C 2

UniProt

Q8KYH8

Expression Region

1-140

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIIRKYHIAIAWTIATSAMLISLIFSEWMKLPPCDLCWYQRMAMYPLVLILGIGMYRKD SNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCTENYLNLFGFISIPMLSFV GFLAIIILLYINQIKRQKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2(UBE2V2)
AP70899-01 20 µg

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2(UBE2V2)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2(UBE2V2)
AP70899-02 100 µg

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2(UBE2V2)

Sign In for Pricing
View Details
Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2(UBE2V2)
AP70899-03 1 mg

Recombinant Human Ubiquitin-conjugating enzyme E2 variant 2(UBE2V2)

Sign In for Pricing
View Details
FABP4 Antibody / Fatty Acid Binding Protein 4
V5248-100UG 100 µg

FABP4 Antibody / Fatty Acid Binding Protein 4

Sign In for Pricing
View Details
Human hsa-miR-376a-5p miRNA Antagomir
abx885694-01 10 nmol

Human hsa-miR-376a-5p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-376a-5p miRNA Antagomir
abx885694-02 20 nmol

Human hsa-miR-376a-5p miRNA Antagomir

Sign In for Pricing
View Details