Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Probable disulfide formation protein C 2 (bdbC2)

This Recombinant Probable disulfide formation protein C 2 (bdbC2) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Probable disulfide formation protein C 2, Disulfide oxidoreductase C 2, Thiol-disulfide oxidoreductase C 2

UniProt

Q8KYH8

Expression Region

1-140

Origin

Bacillus anthracis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIIRKYHIAIAWTIATSAMLISLIFSEWMKLPPCDLCWYQRMAMYPLVLILGIGMYRKD SNVSIYAFPFACIGLIISVYQITIQAFPTSEMKICSVGVSCTENYLNLFGFISIPMLSFV GFLAIIILLYINQIKRQKNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse GPI anchor transamidase (PIGK) ELISA kit
GTR10396250 96 Well

Mouse GPI anchor transamidase (PIGK) ELISA kit

Sign In for Pricing
View Details
TEX44 (H-2) : m-IgG1 BP-HRP Bundle
sc-533015 1 Kit

TEX44 (H-2) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Rabbit Anti-RTDR1 antibody
SL18885R-01 50 µL

Rabbit Anti-RTDR1 antibody

Sign In for Pricing
View Details
Rabbit Anti-RTDR1 antibody
SL18885R-02 100 µL

Rabbit Anti-RTDR1 antibody

Sign In for Pricing
View Details
STBD1 / Genethonin-1 (24-358, His-tag) Human Protein
AR51022PU-N 500 µg

STBD1 / Genethonin-1 (24-358, His-tag) Human Protein

Sign In for Pricing
View Details
Human CCDC167 siRNA
abx910564-01 15 nmol

Human CCDC167 siRNA

Sign In for Pricing
View Details