Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein ywnJ (ywnJ)

This Recombinant Bacillus subtilis Uncharacterized membrane protein ywnJ (ywnJ) spans the amino acid sequence from region 1-140.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein ywnJ

UniProt

P71045

Expression Region

1-140

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRLLLAGWIFFILLSVCTESFSGMVVSQTVAFHFQPHPDLSQFLVMDFTELTVPEAFIQ KIGHAFSFFVLTYLLWKQRGSIRSAAAGSFAFAFFTEVLQLFFSRNGCIRDVLIDAVGIG LFYGLYVLAKRRKQEMYEKY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNA13 Polyclonal Antibody
E-AB-14089-01 20 µL

GNA13 Polyclonal Antibody

Sign In for Pricing
View Details
GNA13 Polyclonal Antibody
E-AB-14089-02 60 µL

GNA13 Polyclonal Antibody

Sign In for Pricing
View Details
GNA13 Polyclonal Antibody
E-AB-14089-03 120 µL

GNA13 Polyclonal Antibody

Sign In for Pricing
View Details
GNA13 Polyclonal Antibody
E-AB-14089-04 200 µL

GNA13 Polyclonal Antibody

Sign In for Pricing
View Details
Cdkal1 Mouse Gene Knockout Kit (CRISPR)
KN503052 1 Kit

Cdkal1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
4-ethyl-4H-furo[3,2-b]pyrrole-5-carboxylic acid
TRC-E902798-10MG 10 mg

4-ethyl-4H-furo[3,2-b]pyrrole-5-carboxylic acid

Sign In for Pricing
View Details