Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

A5IQH6

Expression Region

1-141

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thiethylperazine Dimalate
TRC-T344495-200MG 200 mg

Thiethylperazine Dimalate

Sign In for Pricing
View Details
RGS19 (NM_001039467) Human Over-expression Lysate
LC422051 20 µg

RGS19 (NM_001039467) Human Over-expression Lysate

Sign In for Pricing
View Details
PPIC (NM_000943) Human Over-expression Lysate
LC424438 20 µg

PPIC (NM_000943) Human Over-expression Lysate

Sign In for Pricing
View Details
IFIH1 Antibody
8C11646-AAT 50 µg

IFIH1 Antibody

Sign In for Pricing
View Details
4,5-Dibromo-1,2,6,7-tertahydro-8H-indeno[5,4-b]furan-8-one
TRC-D425478-25MG 25 mg

4,5-Dibromo-1,2,6,7-tertahydro-8H-indeno[5,4-b]furan-8-one

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS709354 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details