Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

A5IQH6

Expression Region

1-141

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAG Recombinant Chimeric Antibody Antibody
HA601414 100 µL

MAG Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
PerCP Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001F-01 20 Tests

PerCP Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details
PerCP Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001F-02 100 Tests

PerCP Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details
PerCP Anti-Human CD3 Antibody[OKT-3]
E-AB-F1001F-03 2x 100 Tests

PerCP Anti-Human CD3 Antibody[OKT-3]

Sign In for Pricing
View Details
CD71 (DF1513), CF740 conjugate, 0.1mg/mL
BNC740188-100 1x 100 µL

CD71 (DF1513), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human CTRP4 (C1QTNF4) activation kit by CRISPRa
GA114489 1 Kit

Human CTRP4 (C1QTNF4) activation kit by CRISPRa

Sign In for Pricing
View Details