Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

A6QET4

Expression Region

1-141

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6N2, CT (OR6N2, Olfactory receptor 6N2, Olfactory receptor OR1-23) (MaxLight 405)
MBS6329366-01 0.1 mL

OR6N2, CT (OR6N2, Olfactory receptor 6N2, Olfactory receptor OR1-23) (MaxLight 405)

Sign In for Pricing
View Details
OR6N2, CT (OR6N2, Olfactory receptor 6N2, Olfactory receptor OR1-23) (MaxLight 405)
MBS6329366-02 5x 0.1 mL

OR6N2, CT (OR6N2, Olfactory receptor 6N2, Olfactory receptor OR1-23) (MaxLight 405)

Sign In for Pricing
View Details
Anti-Benzoyllysine Antibody (6T433)
TMAB-03085-01 20 µL

Anti-Benzoyllysine Antibody (6T433)

Sign In for Pricing
View Details
Anti-Benzoyllysine Antibody (6T433)
TMAB-03085-02 50 μL

Anti-Benzoyllysine Antibody (6T433)

Sign In for Pricing
View Details
FOXP3 (JM2, AIID, DIETER, IPEX, MGC141961, MGC141963, PIDX, XPID, FOXP3delta7, forkhead box protein P3, immune dysregulation, polyendocrinopathy, enteropathy, X-linked, immunodeficiency, polyendocrinopathy, enteropathy, X-linked, scurfin) (BSA & Azide Free) (MaxLight 650)
168777-AF-ML650 100 µL

FOXP3 (JM2, AIID, DIETER, IPEX, MGC141961, MGC141963, PIDX, XPID, FOXP3delta7, forkhead box protein P3, immune dysregulation, polyendocrinopathy, enteropathy, X-linked, immunodeficiency, polyendocrinopathy, enteropathy, X-linked, scurfin) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
CD300C Rabbit Polyclonal Antibody
orb586191 100 µL

CD300C Rabbit Polyclonal Antibody

Sign In for Pricing
View Details