Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

A6TZA0

Expression Region

1-141

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Fallopian tube
CS800363 5x 5 µm

Tissue FFPE Sections, Fallopian tube

Sign In for Pricing
View Details
Arp3 (ACTR3) Mouse Monoclonal Antibody [Clone ID: OTI5G4]
CF812199 100 µg

Arp3 (ACTR3) Mouse Monoclonal Antibody [Clone ID: OTI5G4]

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), Biotin conjugate, 0.1mg/mL
BNCB1380-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (N-Terminal) (Pituitary Marker) (r57), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
STAT5A Rabbit Polyclonal Antibody
AP02590PU-S 50 µL

STAT5A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IGF2 (Center) Rabbit Polyclonal Antibody
AP52163PU-N 200 µL

IGF2 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI2E10]
CF807710 100 µg

NDUFB11 Mouse Monoclonal Antibody [Clone ID: OTI2E10]

Sign In for Pricing
View Details