Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 216 (Tmem216)

This Recombinant Mouse Transmembrane protein 216 (Tmem216) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Transmembrane protein 216, Thymus atrophy-related protein

UniProt

Q9CQC4

Expression Region

1-141

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPRDKRLSSTPLEVLFFLNGWYYATYFLLELLIFLYKGLLLPYPTANLVLDVVMLLLYL GIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFF CGSELLLEMLTLATFSSMDRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP27 (DUPD1) (NM_001003892) Human Over-expression Lysate
LY424030 100 µg

DUSP27 (DUPD1) (NM_001003892) Human Over-expression Lysate

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), CF405S conjugate, 0.1mg/mL
BNC040173-500 1x 500 µL

CD45 / LCA (136-4B5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ASD3 (MYH6) (NM_002471) Human Recombinant Protein
TP313673 20 µg

ASD3 (MYH6) (NM_002471) Human Recombinant Protein

Sign In for Pricing
View Details
cGKI (PRKG1) (NM_001098512) Human Over-expression Lysate
LY420611 100 µg

cGKI (PRKG1) (NM_001098512) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNHIT2 (NM_014205) Human Recombinant Protein
TP308584M 100 µg

ZNHIT2 (NM_014205) Human Recombinant Protein

Sign In for Pricing
View Details
KIF18B (NM_001080443) Human Over-expression Lysate
LY421660 100 µg

KIF18B (NM_001080443) Human Over-expression Lysate

Sign In for Pricing
View Details