Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 216 (Tmem216)

This Recombinant Mouse Transmembrane protein 216 (Tmem216) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Transmembrane protein 216, Thymus atrophy-related protein

UniProt

Q9CQC4

Expression Region

1-141

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPRDKRLSSTPLEVLFFLNGWYYATYFLLELLIFLYKGLLLPYPTANLVLDVVMLLLYL GIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFF CGSELLLEMLTLATFSSMDRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 8 (IL-8) (AP)
MBS6482864-01 0.1 mL

Interleukin 8 (IL-8) (AP)

Sign In for Pricing
View Details
Interleukin 8 (IL-8) (AP)
MBS6482864-02 5x 0.1 mL

Interleukin 8 (IL-8) (AP)

Sign In for Pricing
View Details
ZKSCAN1 (NM_003439) Human Over-expression Lysate
LC418696 20 µg

ZKSCAN1 (NM_003439) Human Over-expression Lysate

Sign In for Pricing
View Details
JRK Protein Vector (Rat) (pPB-N-His)
PV275419 500 ng

JRK Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
ODF3 (NM_001286136) Human Untagged Clone
SC334467 10 µg

ODF3 (NM_001286136) Human Untagged Clone

Sign In for Pricing
View Details
Clecsf6 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV685170 1.0 µg DNA

Clecsf6 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details