Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q0Q2J9

Expression Region

1-141

Origin

Staphylococcus aureus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM65B Rabbit pAb (APR28547N)
APR28547N-01 50 µL

FAM65B Rabbit pAb (APR28547N)

Sign In for Pricing
View Details
FAM65B Rabbit pAb (APR28547N)
APR28547N-02 100 µL

FAM65B Rabbit pAb (APR28547N)

Sign In for Pricing
View Details
FAM65B Rabbit pAb (APR28547N)
APR28547N-03 200 µL

FAM65B Rabbit pAb (APR28547N)

Sign In for Pricing
View Details
Rat C-telopeptide of type II collagen (CTX-II) ELISA Kit
AE48387RA-01 48 Tests

Rat C-telopeptide of type II collagen (CTX-II) ELISA Kit

Sign In for Pricing
View Details
Rat C-telopeptide of type II collagen (CTX-II) ELISA Kit
AE48387RA-02 96 Tests

Rat C-telopeptide of type II collagen (CTX-II) ELISA Kit

Sign In for Pricing
View Details
Serpinc1 Peptide - C-terminal region (AAP41403)
AAP41403-100UG 100 µg

Serpinc1 Peptide - C-terminal region (AAP41403)

Sign In for Pricing
View Details