Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q2G214

Expression Region

1-141

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELF6 Adenovirus (Human)
15858051 1.0 mL

CELF6 Adenovirus (Human)

Sign In for Pricing
View Details
Chmp7 (NM_001108872) Rat Tagged Lenti ORF Clone
RR201169L4 10 µg

Chmp7 (NM_001108872) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TRNAA9 CRISPRa sgRNA lentivector (set of three targets)(Human)
47922121 3x 1.0µg DNA

TRNAA9 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Heme Oxygenase 1 (HMOX1) (NM_002133) Human Untagged Clone
SC128080 10 µg

Heme Oxygenase 1 (HMOX1) (NM_002133) Human Untagged Clone

Sign In for Pricing
View Details
TRIM31 Antibody
OACA08895-100UL 100 µL

TRIM31 Antibody

Sign In for Pricing
View Details
CENPA (NM_001042426) Human Recombinant Protein
PH41334M5 20 µg

CENPA (NM_001042426) Human Recombinant Protein

Sign In for Pricing
View Details