Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q2G214

Expression Region

1-141

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ABCF2 Antibody
NBP2-98977-100ul 100 µL

Rabbit Polyclonal ABCF2 Antibody

Sign In for Pricing
View Details
W/W024/NL334/TW-297X105-1 Electrical & Equipment Safety Signs & Labels (Adhesive)
236100 1 Pack (1 Panel (s) x 1 Pack)

W/W024/NL334/TW-297X105-1 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
Abcc5 3'UTR Lenti-reporter-Luc Vector
11051086 1.0 µg

Abcc5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rat Cardiac Microvascular Endothelial Cells, Neonatal
ABC-TC4109 1 Vial

Rat Cardiac Microvascular Endothelial Cells, Neonatal

Sign In for Pricing
View Details
1- (2,6-difluoro-3-methylphenyl) -2-methoxyethanone
PC1012068-01 250 mg

1- (2,6-difluoro-3-methylphenyl) -2-methoxyethanone

Sign In for Pricing
View Details
1- (2,6-difluoro-3-methylphenyl) -2-methoxyethanone
PC1012068-02 500 mg

1- (2,6-difluoro-3-methylphenyl) -2-methoxyethanone

Sign In for Pricing
View Details