Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q2YSV6

Expression Region

1-141

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,3,4-Trihydroxybenzoic acid
C11540 25 mg

2,3,4-Trihydroxybenzoic acid

Sign In for Pricing
View Details
RFPL4B ORF Vector (Human) (pORF)
38871011 1.0 µg DNA

RFPL4B ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
UPB1 Rabbit Monoclonal Antibody
E28G1450 100 µL

UPB1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Olfr859 Mouse shRNA Lentiviral Particle (Locus ID 258519)
TL509839V 500 µL Each

Olfr859 Mouse shRNA Lentiviral Particle (Locus ID 258519)

Sign In for Pricing
View Details
ERVFRD-1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
19461126 3x 1.0µg DNA

ERVFRD-1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Mouse Polyclonal GCFC2 Antibody
H00006936-B01P 0.05 mg

Mouse Polyclonal GCFC2 Antibody

Sign In for Pricing
View Details