Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q2YSV6

Expression Region

1-141

Origin

Staphylococcus aureus (strain bovine RF122 / ET3-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm2012 Protein Vector (Mouse) (pPB-C-His)
PV183650 500 ng

Gm2012 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal Tmp21/p23 Antibody [Alexa Fluor 647]
NB110-57587AF647 0.1 mL

Rabbit Polyclonal Tmp21/p23 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Cdk6, p40 (Cyclin-dependent Kinase 6, PLSTIRE) (HRP) discontinued
C2576-04-HRP 100 µL

Cdk6, p40 (Cyclin-dependent Kinase 6, PLSTIRE) (HRP) discontinued

Sign In for Pricing
View Details
Olig2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6529406 1.0 µg DNA

Olig2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Alexa Fluor® 647 anti-human CD273 (B7-DC, PD-L2)
GT12300 25 Tests

Alexa Fluor® 647 anti-human CD273 (B7-DC, PD-L2)

Sign In for Pricing
View Details
Beta-Amyloid 1-40 (CT) Rabbit Polyclonal Antibody (BF647)
orb1816102 100 µL

Beta-Amyloid 1-40 (CT) Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details