Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q5HRB1

Expression Region

1-141

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLKSVTKIVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFDVNEV LKSLPIDFKKLMIIGSLISVATASVPMFFGKPFLYQTEANVTFPLLGHVHVTTVTLFELG ILLTVVGVIVTVMLSISGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Mip shRNA (UAS) - Lentiviral mouse Mip shRNA (UAS, RFP) plasmid
GTR15215017 1 Vial

Lentiviral mouse Mip shRNA (UAS) - Lentiviral mouse Mip shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Ide Mouse shRNA Plasmid (Locus ID 15925)
TR501034 1 Kit

Ide Mouse shRNA Plasmid (Locus ID 15925)

Sign In for Pricing
View Details
KCNK4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV651469 1.0 µg DNA

KCNK4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
GLG1 ORF Vector (Human) (pORF)
ORF020191 1.0 µg DNA

GLG1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Ssr1 3'UTR GFP Stable Cell Line
TU271220 1.0 mL

Ssr1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
PHLA2 Antibody
E18-0668-2 100 µg -100 µL

PHLA2 Antibody

Sign In for Pricing
View Details