Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q6GBK6

Expression Region

1-141

Origin

Staphylococcus aureus (strain MSSA476)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae GPI transamidase component GAA1 (GAA1)
MBS1060883 Inquire

Recombinant Saccharomyces cerevisiae GPI transamidase component GAA1 (GAA1)

Sign In for Pricing
View Details
Antibiotic A 40926 (Mixture)
TRC-A697390-10MG 10 mg

Antibiotic A 40926 (Mixture)

Sign In for Pricing
View Details
Rabbit anti Sweet potato b-Amylase, conjugated with Biotin
NE017/Bio 1 mL

Rabbit anti Sweet potato b-Amylase, conjugated with Biotin

Sign In for Pricing
View Details
NMDA Receptor NR2B, phosphorylated (Tyr1336) (NMDA R2b, NMDAR2B, N-methyl-D-aspartate, GRIN2B, Glutamate [NMDA] Receptor Subunit epsilon-2, NR2B, N-methyl-D-aspartate Receptor Subunit 2B) (MaxLight 650) discontinued
N2904-35J-ML650 100 µL

NMDA Receptor NR2B, phosphorylated (Tyr1336) (NMDA R2b, NMDAR2B, N-methyl-D-aspartate, GRIN2B, Glutamate [NMDA] Receptor Subunit epsilon-2, NR2B, N-methyl-D-aspartate Receptor Subunit 2B) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Mouse CD47 ELISA Kit
E047725-01 1 Each

Mouse CD47 ELISA Kit

Sign In for Pricing
View Details
Mouse CD47 ELISA Kit
E047725-02 1 Each

Mouse CD47 ELISA Kit

Sign In for Pricing
View Details