Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q7A727

Expression Region

1-141

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conjugated EWSR1 Rabbit mAb
C59969 100 µL

Conjugated EWSR1 Rabbit mAb

Sign In for Pricing
View Details
PSB 06126
B7113-50 50 mg

PSB 06126

Sign In for Pricing
View Details
Rabbit Polyclonal TANC1 Antibody [Janelia Fluor 549]
NBP1-52630JF549 0.1 mL

Rabbit Polyclonal TANC1 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Anti-Procainamide Antibody
16701-1000-1 1 mg

Anti-Procainamide Antibody

Sign In for Pricing
View Details
MOCS2 Human qPCR Primer Pair (NM_004531)
HP207827 200 Reactions

MOCS2 Human qPCR Primer Pair (NM_004531)

Sign In for Pricing
View Details
Mouse Monoclonal Lgr6 Antibody (918726) [mFluor Violet 610 SE]
FAB84581MFV610 0.1 mL

Mouse Monoclonal Lgr6 Antibody (918726) [mFluor Violet 610 SE]

Sign In for Pricing
View Details