Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q8CQ49

Expression Region

1-141

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLKSVTKIVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFDVNEV LKSLPIDFKKLMIIGSLISVATASVPMFFGKPFLYQTEANVTFPLLGHVHVTTVTLFELG ILLTVVGVIVTVMLSISGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF640R conjugate, 0.1mg/mL
BNC401481-100 1x 100 µL

S100A4 (Marker of Tumor Metastasis) (S100A4/1481), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit
E-EL-H0145-01 24 Tests

Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit

Sign In for Pricing
View Details
Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit
E-EL-H0145-02 48 Tests

Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit

Sign In for Pricing
View Details
Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit
E-EL-H0145-03 96 Tests

Human PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit

Sign In for Pricing
View Details
Water Chiller BCHI-205
BCHI-205 Each

Water Chiller BCHI-205

Sign In for Pricing
View Details
1-(3,4-Dichlorophenyl)piperazine
TRC-B419560-500MG 500 mg

1-(3,4-Dichlorophenyl)piperazine

Sign In for Pricing
View Details