Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q8CQ49

Expression Region

1-141

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLKSVTKIVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFDVNEV LKSLPIDFKKLMIIGSLISVATASVPMFFGKPFLYQTEANVTFPLLGHVHVTTVTLFELG ILLTVVGVIVTVMLSISGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 8 (KRT8) (rB22.1), CF568 conjugate, 0.1mg/mL
BNC682175-500 1x 500 µL

Cytokeratin 8 (KRT8) (rB22.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), 0.2mg/mL
BNUB2344-100 1x 100 µL

CD44v9 (Marker of Tumor Metastasis) (CD44v9/2344R), 0.2mg/mL

Sign In for Pricing
View Details
Chromogranin A (CGA/414), CF405S conjugate, 0.1mg/mL
BNC040414-500 1x 500 µL

Chromogranin A (CGA/414), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/2770), CF405S conjugate, 0.1mg/mL
BNC042770-500 1x 500 µL

TRAF1 (TNFR-Associated Factor 1) (Lymphomatoid Papulosis Marker) (TRAF1/2770), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1963), CF594 conjugate, 0.1mg/mL
BNC941963-100 1x 100 µL

Tryptase (Mast Cell Marker) (TPSAB1/1963), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF647 conjugate, 0.1mg/mL
BNC473168-100 1x 100 µL

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details