Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus epidermidis Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q8CQ49

Expression Region

1-141

Origin

Staphylococcus epidermidis (strain ATCC 12228)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLKSVTKIVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFDVNEV LKSLPIDFKKLMIIGSLISVATASVPMFFGKPFLYQTEANVTFPLLGHVHVTTVTLFELG ILLTVVGVIVTVMLSISGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Progesterone Metabolites ELISA Kit
K068-H1 1 Plate

Progesterone Metabolites ELISA Kit

Sign In for Pricing
View Details
MEIS1 Recombinant Rabbit Monoclonal Antibody [JA13-26]
ET1704-84 100 µL

MEIS1 Recombinant Rabbit Monoclonal Antibody [JA13-26]

Sign In for Pricing
View Details
LITAF (NM_001136472) Human Over-expression Lysate
LC427883 20 µg

LITAF (NM_001136472) Human Over-expression Lysate

Sign In for Pricing
View Details
NIRF (UHRF2) Human qPCR Primer Pair (NM_152896)
HP231151 200 Reactions

NIRF (UHRF2) Human qPCR Primer Pair (NM_152896)

Sign In for Pricing
View Details
C3orf23 (TCAIM) (NM_173826) Human Recombinant Protein
TP324319 20 µg

C3orf23 (TCAIM) (NM_173826) Human Recombinant Protein

Sign In for Pricing
View Details
DL-Prolinamide
TRC-P755965-250MG 250 mg

DL-Prolinamide

Sign In for Pricing
View Details