Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q99VZ1

Expression Region

1-141

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mtmr7 (BC032254) Mouse Tagged ORF Clone Lentiviral Particle
MR207467L3V 200 µL

Mtmr7 (BC032254) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
P73 Antibody
48918-01 50 µL

P73 Antibody

Sign In for Pricing
View Details
P73 Antibody
48918-02 100 µL

P73 Antibody

Sign In for Pricing
View Details
Mouse Anti-Human CD107b-AF488
9840-30 100 Tests

Mouse Anti-Human CD107b-AF488

Sign In for Pricing
View Details
Anti-MOGAT2 Antibody
MBS8322672-01 0.03 mL

Anti-MOGAT2 Antibody

Sign In for Pricing
View Details
Anti-MOGAT2 Antibody
MBS8322672-02 0.05 mL

Anti-MOGAT2 Antibody

Sign In for Pricing
View Details