Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q99VZ1

Expression Region

1-141

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclo (Pro-Trp)
379976 10 mg

Cyclo (Pro-Trp)

Sign In for Pricing
View Details
CLEC7A, NT (CLEC7A, BGR, CLECSF12, DECTIN1, C-type lectin domain family 7 member A, Beta-glucan receptor, C-type lectin superfamily member 12, Dendritic cell-associated C-type lectin 1) (APC) discontinued
033988-APC 200 µL

CLEC7A, NT (CLEC7A, BGR, CLECSF12, DECTIN1, C-type lectin domain family 7 member A, Beta-glucan receptor, C-type lectin superfamily member 12, Dendritic cell-associated C-type lectin 1) (APC) discontinued

Sign In for Pricing
View Details
PRDM4 Rabbit pAb, PE-Cy5.5 conjugated
orb2873232 100 µL

PRDM4 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
EPO-alpha Human
PR27065-01 5 µg

EPO-alpha Human

Sign In for Pricing
View Details
EPO-alpha Human
PR27065-02 50 µg

EPO-alpha Human

Sign In for Pricing
View Details
BAGE2 discontinued
533476-01 30ul

BAGE2 discontinued

Sign In for Pricing
View Details