Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 216 (Tmem216)

This Recombinant Rat Transmembrane protein 216 (Tmem216) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Transmembrane protein 216

UniProt

B6ID01

Expression Region

1-141

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPRDKRLSSTPLEILFFLNGWYYATYFLLELLIFLYKGLLLPYPTANLVLDVVMLLLYL GIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFF CGSELLLEMLTLATFSSMDRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-100 1x 100 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-100 1x 100 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL
BNC881073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
BNC550017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAG-72 / CA72.4 (CC49), CF647 conjugate, 0.1mg/mL
BNC470732-100 1x 100 µL

TAG-72 / CA72.4 (CC49), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX7 (PAX7/1187), CF640R conjugate, 0.1mg/mL
BNC401187-100 1x 100 µL

PAX7 (PAX7/1187), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details