Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

P60679

Expression Region

1-142

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC065085 (BC060626) Mouse Tagged ORF Clone
MG201184 10 µg

BC065085 (BC060626) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tissue FFPE Sections, Spleen
CS808998 5x 5 µm

Tissue FFPE Sections, Spleen

Sign In for Pricing
View Details
Urinary Creatinine Detection Kit
K002-H5 10 Plates

Urinary Creatinine Detection Kit

Sign In for Pricing
View Details
HDLBP Rabbit Polyclonal Antibody
TA367076 100 µL

HDLBP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin, Multi (Epithelial Marker) (rKRT/457), CF647 conjugate, 0.1mg/mL
BNC471876-100 1x 100 µL

Cytokeratin, Multi (Epithelial Marker) (rKRT/457), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human GPR56 (ADGRG1) activation kit by CRISPRa
GA106194 1 Kit

Human GPR56 (ADGRG1) activation kit by CRISPRa

Sign In for Pricing
View Details