Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

P60679

Expression Region

1-142

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitoquinol-d15
TRC-M372212-1MG 1 mg

Mitoquinol-d15

Sign In for Pricing
View Details
Vimentin (VIM) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A9]
TA801119AM 100 µL

Vimentin (VIM) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A9]

Sign In for Pricing
View Details
EIF4A2 (C-term) Rabbit Polyclonal Antibody
AP51399PU-N 400 µL

EIF4A2 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD147 (BSG) Human Gene Knockout Kit (CRISPR)
KN203894 1 Kit

CD147 (BSG) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GAL4 Rabbit Polyclonal Antibody
ER1902-63 100 µL

GAL4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TGIF2LY (NM_139214) Human Recombinant Protein
TP321598L 1 mg

TGIF2LY (NM_139214) Human Recombinant Protein

Sign In for Pricing
View Details