Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

P60679

Expression Region

1-142

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf29 (ABHD18) (NM_001039717) Human Over-expression Lysate
LY421818 100 µg

C4orf29 (ABHD18) (NM_001039717) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP6J (ATP6V1G1) Rabbit Polyclonal Antibody
TA362368 100 µL

ATP6J (ATP6V1G1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-EL-H0185-01 24 Tests

Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-EL-H0185-02 48 Tests

Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit
E-EL-H0185-03 96 Tests

Human PINP (Procollagen I N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Dibenzyl Terephthalate
TRC-D417235-50MG 50 mg

Dibenzyl Terephthalate

Sign In for Pricing
View Details