Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

P60676

Expression Region

1-142

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERPINB2 Rabbit Polyclonal Antibody
AP20791PU-N 100 µg

SERPINB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF640R conjugate, 0.1mg/mL
BNC402110-100 1x 100 µL

PTEN (Tumor Suppressor Oncoprotein) (PTEN/2110), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TBL1 (TBL1X) Human Gene Knockout Kit (CRISPR)
KN213516 1 Kit

TBL1 (TBL1X) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DMXL2 Antibody
KC-11724-01 50 μL

DMXL2 Antibody

Sign In for Pricing
View Details
DMXL2 Antibody
KC-11724-02 100 µL

DMXL2 Antibody

Sign In for Pricing
View Details
DMXL2 Antibody
KC-11724-03 1 mL

DMXL2 Antibody

Sign In for Pricing
View Details