Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

P60676

Expression Region

1-142

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hCG beta (CGB5) activation kit by CRISPRa
GA114300 1 Kit

Human hCG beta (CGB5) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Histone H3 (di methyl K79) Antibody
RC-6883-01 50 μL

Recombinant Histone H3 (di methyl K79) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (di methyl K79) Antibody
RC-6883-02 100 µL

Recombinant Histone H3 (di methyl K79) Antibody

Sign In for Pricing
View Details
Recombinant Histone H3 (di methyl K79) Antibody
RC-6883-03 1 mL

Recombinant Histone H3 (di methyl K79) Antibody

Sign In for Pricing
View Details
MOSPD1 Human Gene Knockout Kit (CRISPR)
KN401517 1 Kit

MOSPD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bone sialoprotein 2 Recombinant Rabbit monoclonal Antibody
HA723129 100 µL

Bone sialoprotein 2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details