Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

A5IRC9

Expression Region

1-142

Origin

Staphylococcus aureus (strain JH9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXA5 Rabbit Polyclonal Antibody (RBITC)
orb1043571 100 µL

HOXA5 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
STF-62247
S1041-25mg 25 mg

STF-62247

Sign In for Pricing
View Details
Plant Proline Rich Protein 4, Lacrimal (PRR4) ELISA Kit
MBS9378092 Inquire

Plant Proline Rich Protein 4, Lacrimal (PRR4) ELISA Kit

Sign In for Pricing
View Details
Benzyl[bis (2-chloroethyl) ]amine hydrochloride
OR24559 250 mg

Benzyl[bis (2-chloroethyl) ]amine hydrochloride

Sign In for Pricing
View Details
Fermt2 ORF Vector (Mouse) (pORF)
ORF044777 1.0 µg DNA

Fermt2 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Semaphorin 3F (SEMA3F)
MBS2096905-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Semaphorin 3F (SEMA3F)

Sign In for Pricing
View Details