Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

A6U058

Expression Region

1-142

Origin

Staphylococcus aureus (strain JH1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Breast
CS639042 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Recombinant Human IL7R Protein (Fc Tag)
PDMH100238-01 20 µg

Recombinant Human IL7R Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL7R Protein (Fc Tag)
PDMH100238-02 100 µg

Recombinant Human IL7R Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL7R Protein (Fc Tag)
PDMH100238-03 500 µg

Recombinant Human IL7R Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human IL7R Protein (Fc Tag)
PDMH100238-04 1 mg

Recombinant Human IL7R Protein (Fc Tag)

Sign In for Pricing
View Details
Tnfsf9 Mouse Gene Knockout Kit (CRISPR)
KN518004 1 Kit

Tnfsf9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details