Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

A6QFG1

Expression Region

1-142

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E/E002/FR3-PP-PHOLUMB-400x200/1-B Facility & Office Signs (No Adhesive)
836517 1 Pack (1 Panel (s) x 1 Pack)

E/E002/FR3-PP-PHOLUMB-400x200/1-B Facility & Office Signs (No Adhesive)

Sign In for Pricing
View Details
FAM179B siRNA (Mouse)
MBS8207330-01 15 nmol

FAM179B siRNA (Mouse)

Sign In for Pricing
View Details
FAM179B siRNA (Mouse)
MBS8207330-02 30 nmol

FAM179B siRNA (Mouse)

Sign In for Pricing
View Details
FAM179B siRNA (Mouse)
MBS8207330-03 5x 30 nmol

FAM179B siRNA (Mouse)

Sign In for Pricing
View Details
ADA33 Polyclonal Antibody
E11-200410 100 µg -100 µL

ADA33 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Lung Cancer Marker MOC-52 Antibody (MOC-52)
NBP2-45277-0.02mg 0.02 mg

Mouse Monoclonal Lung Cancer Marker MOC-52 Antibody (MOC-52)

Sign In for Pricing
View Details