Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

A6QFG1

Expression Region

1-142

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal RFPL1 Antibody (OTI1D3) [CoraFluor 1]
NBP2-73861CL1 0.1 mL

Mouse Monoclonal RFPL1 Antibody (OTI1D3) [CoraFluor 1]

Sign In for Pricing
View Details
Guinea pig adrenomedullin, ADM ELISA Kit
GTR10478673-01 48 Well

Guinea pig adrenomedullin, ADM ELISA Kit

Sign In for Pricing
View Details
Guinea pig adrenomedullin, ADM ELISA Kit
GTR10478673-02 96 Well

Guinea pig adrenomedullin, ADM ELISA Kit

Sign In for Pricing
View Details
Guinea pig adrenomedullin, ADM ELISA Kit
GTR10478673-03 192 Well

Guinea pig adrenomedullin, ADM ELISA Kit

Sign In for Pricing
View Details
CD20 (MS4A1, B1, S7, Bp35, MS4A2, LEU-16, MGC3969, membrane-spanning 4-domains, subfamily A, member 1, B-lymphocyte cell-surface antigen B1) (MaxLight 490) discontinued
C2270-05C-ML490 100 µL

CD20 (MS4A1, B1, S7, Bp35, MS4A2, LEU-16, MGC3969, membrane-spanning 4-domains, subfamily A, member 1, B-lymphocyte cell-surface antigen B1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
EBNA 3B Polyclonal Antibody, APC Conjugated
bs-4698R-APC 100 µL

EBNA 3B Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details