Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

A6QFG1

Expression Region

1-142

Origin

Staphylococcus aureus (strain Newman)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Butyrophilin-like protein 2 (BTNL2) ELISA Kit
MBS7206254-01 48 Well

Bovine Butyrophilin-like protein 2 (BTNL2) ELISA Kit

Sign In for Pricing
View Details
Bovine Butyrophilin-like protein 2 (BTNL2) ELISA Kit
MBS7206254-02 96 Well

Bovine Butyrophilin-like protein 2 (BTNL2) ELISA Kit

Sign In for Pricing
View Details
Bovine Butyrophilin-like protein 2 (BTNL2) ELISA Kit
MBS7206254-03 5x 96 Well

Bovine Butyrophilin-like protein 2 (BTNL2) ELISA Kit

Sign In for Pricing
View Details
Bovine Butyrophilin-like protein 2 (BTNL2) ELISA Kit
MBS7206254-04 10x 96 Well

Bovine Butyrophilin-like protein 2 (BTNL2) ELISA Kit

Sign In for Pricing
View Details
USP36 Mouse Monoclonal Antibody [Clone ID: OTI3B9]
TA800096S 30 µL

USP36 Mouse Monoclonal Antibody [Clone ID: OTI3B9]

Sign In for Pricing
View Details
Cytochrome c Colorimetric Cell-Based ELISA Kit (OKAG00659)
OKAG00659 96 Well

Cytochrome c Colorimetric Cell-Based ELISA Kit (OKAG00659)

Sign In for Pricing
View Details