Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

A7X0G1

Expression Region

1-142

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ICAM-2/CD102 Protein (His Tag)
PKSH033641-01 10 µg

Recombinant Human ICAM-2/CD102 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ICAM-2/CD102 Protein (His Tag)
PKSH033641-02 50 µg

Recombinant Human ICAM-2/CD102 Protein (His Tag)

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF405S conjugate, 0.1mg/mL
BNC041475-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1475), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Anti-Mouse CD90 (T24/31) In Vivo Antibody - Low Endotoxin
ICH1064-5mg 5 mg

Anti-Mouse CD90 (T24/31) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Vilaprisan-D4
TRC-V995621-25MG 25 mg

Vilaprisan-D4

Sign In for Pricing
View Details
Recombinant Mouse TNFRSF1B/CD120b Protein (Fc Tag)
PKSM040847 100 µg

Recombinant Mouse TNFRSF1B/CD120b Protein (Fc Tag)

Sign In for Pricing
View Details