Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit B1 spans the amino acid sequence from region 1-142.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit B1, Mnh complex subunit B1

UniProt

A7X0G1

Expression Region

1-142

Origin

Staphylococcus aureus (strain Mu3 / ATCC 700698)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNRQQNDLILQFAAVIIFFMVMVFGFSLFLAGHYTPGGGFVGGLLFASSLVIITIAFDIE TMRKIFPLDFKILIGIGLVFCIATPIASWFLGKNFFTHVTFDIPLFILEPVHMTTAVFFD FGVLCAVVGTVMTIIISIGENE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CRYGN activation kit by CRISPRa
GA115907 1 Kit

Human CRYGN activation kit by CRISPRa

Sign In for Pricing
View Details
3-Quinuclidinone Hydrochloride
TRC-Q795795-10G 10 g

3-Quinuclidinone Hydrochloride

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), 0.2mg/mL
BNUB0634-500 1x 500 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), 0.2mg/mL

Sign In for Pricing
View Details
Human RADIL activation kit by CRISPRa
GA110892 1 Kit

Human RADIL activation kit by CRISPRa

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF594 conjugate, 0.1mg/mL
BNC942301-500 1x 500 µL

PAX5 / BSAP (Early B-Cell Marker) (rPAX5/2060), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CREBZF Polyclonal Antibody
E-AB-53232-01 20 µL

CREBZF Polyclonal Antibody

Sign In for Pricing
View Details